PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000879912
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family VOZ
Protein Properties Length: 603aa    MW: 66882.1 Da    PI: 6.6353
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000879912genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ438.58.6e-1353265421217
            VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelf 96 
                    pppsaflgpkcalwdc+rpaqg++w+ dycssfha+lalneg+pg+ pvlrp+gi+lkdgllfaalsak+qgk+vgipecegaatakspwna elf
  MDP0000879912 326 PPPSAFLGPKCALWDCPRPAQGMDWWLDYCSSFHAALALNEGPPGMGPVLRPGGIGLKDGLLFAALSAKAQGKSVGIPECEGAATAKSPWNARELF 421
                    89********************************************************************************************** PP

            VOZ  97 dlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvde 192
                    dls+lege irewlffdkprrafesgnrkqrslpdy+grgwhesrkqvm+e+gglkrsyymdpqps++fewhlyeyein++da+alyrlelklvd+
  MDP0000879912 422 DLSVLEGEVIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVMNEYGGLKRSYYMDPQPSNHFEWHLYEYEINKCDACALYRLELKLVDG 517
                    ************************************************************************************************ PP

            VOZ 193 kksakgkvskdsladlqkklgrlta 217
                    kk++kgk+++ds+adlqk++grl+a
  MDP0000879912 518 KKNSKGKLTNDSVADLQKQMGRLSA 542
                    ***********************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MVLMSFATAH ASHSFNPFTS VHAGRTCAFT FHSAPARHGE SESERKEKPP LLPSTELSRF  60
HTSRRCHPKP SRPPDPNSLS VGLEGGGCVM KGSKSNCKSA SHNLFKDKAK NRVDDLQGMF  120
MDLQFARKES RSIDAALLEE QVHQMLREWK AELNEPSPAS SLQQQGGSLG SFSSDICRLL  180
QLCEEEDDAT SPLAAPKPEP NDQNLQVGES LVFHELCALF FRFEMKSESV VYEHSLVVAN  240
TIYQGFSVNQ GQQEHAMPLA DQSKSSPSGV RNVAVNNLEG ANQLDYHQFE LHQDFEQSFY  300
PCFNATALSG EDTLPQVSTY LPSIFPPPSA FLGPKCALWD CPRPAQGMDW WLDYCSSFHA  360
ALALNEGPPG MGPVLRPGGI GLKDGLLFAA LSAKAQGKSV GIPECEGAAT AKSPWNAREL  420
FDLSVLEGEV IREWLFFDKP RRAFESGNRK QRSLPDYNGR GWHESRKQVM NEYGGLKRSY  480
YMDPQPSNHF EWHLYEYEIN KCDACALYRL ELKLVDGKKN SKGKLTNDSV ADLQKQMGRL  540
SAEFPIDNKR IVKGRAKVNA KVGVGNVYHS PNRGTTTNAT FDYGSGAPYD YLLDDVNGYY  600
IT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.9500.0bud| fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5310230.0AB531023.1 Malus x domestica MdVOZ1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008383671.10.0PREDICTED: transcription factor VOZ1
RefseqXP_008383672.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLD5MRQ40.0D5MRQ4_MALDO; MdVOZ1 protein
STRINGPOPTR_0004s05030.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein